Protein Info for MMP_RS06005 in Methanococcus maripaludis S2
Annotation: heavy-metal-associated domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 34% identical to Y292_HAEIN: Uncharacterized protein HI_0292 (HI_0292) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: None (inferred from 100% identity to mmp:MMP1164)Predicted SEED Role
"Copper chaperone" in subsystem Copper homeostasis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LY29 at UniProt or InterPro
Protein Sequence (72 amino acids)
>MMP_RS06005 heavy-metal-associated domain-containing protein (Methanococcus maripaludis S2) MEELKLKISGMSCQMCVKTIKNLLSELEGIINVDIDLEAGLGTVTYDEKILNEEEILKNE AFELYPAEKLAN