Protein Info for MMP_RS06000 in Methanococcus maripaludis S2

Annotation: divalent-cation tolerance protein CutA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF03091: CutA1" amino acids 6 to 99 (94 residues), 81.5 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 46% identical to CUTA_PYRHO: Divalent-cation tolerance protein CutA (cutA) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K03926, periplasmic divalent cation tolerance protein (inferred from 100% identity to mmp:MMP1163)

Predicted SEED Role

"Periplasmic divalent cation tolerance protein CutA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY30 at UniProt or InterPro

Protein Sequence (104 amino acids)

>MMP_RS06000 divalent-cation tolerance protein CutA (Methanococcus maripaludis S2)
MEKPTLVYTTFPNFETAKSIVGYLLEKKMIACANLREHEAHYFNDGDLSINTEIGAFLKT
TENRWISLKDMINEIHPLETPAILKINIDDSNDEFKNWILNIIK