Protein Info for MMP_RS05980 in Methanococcus maripaludis S2

Annotation: ferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00210: Ferritin" amino acids 9 to 142 (134 residues), 148 bits, see alignment E=9.3e-48

Best Hits

Swiss-Prot: 41% identical to FTN_STAS1: Bacterial non-heme ferritin (ftnA) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: K02217, ferritin [EC: 1.16.3.1] (inferred from 100% identity to mmp:MMP1159)

Predicted SEED Role

"Ferritin-like protein 2"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY34 at UniProt or InterPro

Protein Sequence (171 amino acids)

>MMP_RS05980 ferritin (Methanococcus maripaludis S2)
MDGKLRCEIEEQINKEFYSAYLYLAMSNYAESNGFKGISNWFIVQSQEELDHAMKFYNYV
HSMGETLELGAIDKPEPRWNSIIDVFENGLTHEKYVTQRIHKLMDIAHEVKDYAAISMLQ
WFVNEQIEEESSFRDILDKLKLTGGDVNYLMVLDGELGQRVRTPPQSETNE