Protein Info for MMP_RS05905 in Methanococcus maripaludis S2

Annotation: undecaprenyl-diphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details PF02673: BacA" amino acids 4 to 242 (239 residues), 237 bits, see alignment E=1.5e-74

Best Hits

Swiss-Prot: 100% identical to UPPP_METMP: Undecaprenyl-diphosphatase (uppP) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to mmp:MMP1144)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60942 at UniProt or InterPro

Protein Sequence (249 amino acids)

>MMP_RS05905 undecaprenyl-diphosphate phosphatase (Methanococcus maripaludis S2)
MEELILGIVQGLTEFLPISSSGHLAIFTALFNSTPDVGYFAFLHLATFLAVLIFVKAEVF
EIITGITKKETEYINLASKLVLSTIPAVIVGLCFGDFIESVFSSTLLIGVFLSITGILML
LSDNLNKNLKTIKSIPYWDALIIGVFQAFSVLPGISRSGTTLFAALFLGMNKEDAVKYSF
LMSLPVTFGAGILELQKITFSSEQLFGFVISFLTGLLGLYLVKKMVIGGKLKIFGYYCFL
ASFFVIMFL