Protein Info for MMP_RS05900 in Methanococcus maripaludis S2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF12895: ANAPC3" amino acids 22 to 81 (60 residues), 31.7 bits, see alignment E=6.8e-11 PF07719: TPR_2" amino acids 24 to 56 (33 residues), 28 bits, see alignment E=6.9e-10 PF00515: TPR_1" amino acids 25 to 56 (32 residues), 30.6 bits, see alignment E=9.7e-11 PF13181: TPR_8" amino acids 27 to 56 (30 residues), 19.3 bits, see alignment E=4.2e-07 amino acids 59 to 82 (24 residues), 19.8 bits, see alignment 3e-07 PF13432: TPR_16" amino acids 29 to 83 (55 residues), 35.3 bits, see alignment E=5.5e-12 PF14559: TPR_19" amino acids 36 to 101 (66 residues), 27 bits, see alignment E=2.2e-09 PF13431: TPR_17" amino acids 46 to 78 (33 residues), 24 bits, see alignment E=1.5e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1143)

Predicted SEED Role

"TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY49 at UniProt or InterPro

Protein Sequence (122 amino acids)

>MMP_RS05900 tetratricopeptide repeat protein (Methanococcus maripaludis S2)
LKKELILLGILISISFAGCVDQNPEEYYSKGILQYDDGNYTESIDLFEKAIQLNPEESKY
WLMKGKALYNLERYEEAVDCYNYVINVIEDEYNKDVWAAKADALRHIEGKEVEAEIAEAR
AK