Protein Info for MMP_RS05875 in Methanococcus maripaludis S2

Annotation: hydroxyethylthiazole kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to THIM_METMP: Hydroxyethylthiazole kinase (thiM) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00878, hydroxyethylthiazole kinase [EC: 2.7.1.50] (inferred from 100% identity to mmp:MMP1138)

Predicted SEED Role

"Hydroxyethylthiazole kinase (EC 2.7.1.50)" in subsystem Thiamin biosynthesis (EC 2.7.1.50)

MetaCyc Pathways

thiamine diphosphate salvage II (5/5 steps found)
thiamine diphosphate salvage V (3/3 steps found)
thiamine diphosphate salvage IV (yeast) (4/7 steps found)
thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)

KEGG Metabolic Maps

Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY53 at UniProt or InterPro

Protein Sequence (266 amino acids)

>MMP_RS05875 hydroxyethylthiazole kinase (Methanococcus maripaludis S2)
MDFVAKNLTKLRETNPLVQNITNYVVMNSTANSLLALGASPVMAHAMDELEEMVSIASAL
VVNIGTLDEYWIPSMEKAAKIASDLKKPIVLDPVGAGATKLRTKTALKILDFADISVLRG
NFGEIAAVLGEHGKTRGVDSAAYDSNEAIELSKNAAKEFNTVSAVTGPVDHVSNGKEIYS
ISNGHSMLSKVTGTGCATTSIIGAFSAVDDPLKAAVSGLVVYGISAEMAFTEAPYPGTFQ
AKVYDWLYRIDEKLVLEKAKVNKFEI