Protein Info for MMP_RS05840 in Methanococcus maripaludis S2

Annotation: peptide chain release factor aRF-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR03676: peptide chain release factor 1, archaeal and eukaryotic forms" amino acids 9 to 418 (410 residues), 596.5 bits, see alignment E=1.2e-183 PF03463: eRF1_1" amino acids 14 to 134 (121 residues), 71.3 bits, see alignment E=1.5e-23 PF18854: baeRF_family10" amino acids 128 to 268 (141 residues), 51.3 bits, see alignment E=3.1e-17 PF03464: eRF1_2" amino acids 142 to 274 (133 residues), 150.8 bits, see alignment E=5.7e-48 PF03465: eRF1_3" amino acids 277 to 419 (143 residues), 93 bits, see alignment E=3.2e-30

Best Hits

Swiss-Prot: 100% identical to RF1_METMP: Peptide chain release factor subunit 1 (prf1) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03265, peptide chain release factor subunit 1 (inferred from 100% identity to mmp:MMP1131)

Predicted SEED Role

"Eukaryotic peptide chain release factor subunit 1" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61731 at UniProt or InterPro

Protein Sequence (419 amino acids)

>MMP_RS05840 peptide chain release factor aRF-1 (Methanococcus maripaludis S2)
MSGNSSTDLYLFKKSLKELKGKKGKGTELISVYVPAGRRLSDISQYLRQELSQSSNIKSK
TTMKNVQSAIEVILQRLKLLKEPLEMGVIIFAGMIPRGGPGTEKMEVYVLEPPEPVKTFV
YRCDSLFYTDPLEDFIQDNEVYGVILVDRNEATIGTVRGKTITILKKLTSGVPGKFKAGG
QSARRLERLIDDAAHQFMVRIGEYATESFMPILEEKKLKGLLLGGPGNTKNEFAEKDYLH
HELKKKIIDTFDLCYTEEFGIRELLDKASDLLRDIDLMKEKNLIQRFFKELIKDDGGLSA
YGEAQVMKYLEMGAIDTLIVTEDIGITRVTVKCNNCDITQEVNVKTNEMFKFEEQLKTKA
CPTCGGAMYIDEEKDIIEYLSDLCNMHNTDLIVVSTDTEEGSQISRAFKGMAAILRYKL