Protein Info for MMP_RS05820 in Methanococcus maripaludis S2

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 PF09371: Tex_N" amino acids 1 to 75 (75 residues), 100.9 bits, see alignment E=1.2e-32 PF22706: Tex_central_region" amino acids 137 to 297 (161 residues), 106 bits, see alignment E=1.1e-33 PF16921: Tex_YqgF" amino acids 313 to 438 (126 residues), 183.9 bits, see alignment E=6.8e-58 PF14635: HHH_7" amino acids 451 to 544 (94 residues), 36.5 bits, see alignment E=2.3e-12 PF12836: HHH_3" amino acids 478 to 542 (65 residues), 104.2 bits, see alignment E=1.4e-33 PF17674: HHH_9" amino acids 548 to 620 (73 residues), 78.2 bits, see alignment E=3.2e-25 PF00575: S1" amino acids 638 to 710 (73 residues), 63.8 bits, see alignment E=7.1e-21

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to mmp:MMP1127)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY64 at UniProt or InterPro

Protein Sequence (713 amino acids)

>MMP_RS05820 RNA-binding transcriptional accessory protein (Methanococcus maripaludis S2)
MDIFQQLQKEFNLKTFQVENTVKLIDEGNTIPFISRYRKEATGSLDDVVLRKFFDRLNYL
RNLEDKKAQIIKLIDEQGKLTAELKQKIEKSELLTELEDIYRPFRPKRKTRATIAESKGL
KPLSELILKQILEKPIEELAEGFVNPELEVNSVEDAISGAKDIIAEEISDNADYRKFIRE
NTFSEGIISVKAKNVDEKSVYEMYYEYSEAINKIPGHRILAINRGESEKILQVKLDAPVE
FIHDWIFKNIILENSQTSEILKDTVIDSYKRLIAPSIEREIRNSLTEKAENGAIEVFSKN
LKQLLLQPPIKNKTVLGWDPAFRTGCKIALVDETGKVLDKTVVYPTEPHNKVTETKKQVK
ELIIKYDIDVVAIGNGTASRESEHIVSEILKEVVNDVYYVIVNEAGASVYSASELGSDEF
PEYDVGIRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDMNQKKLSESLGAVVESSVNS
VGVDLNTASVSLLNYVSGINIGIAKNIVAYRTENGKFESRKELLKVSKLGKKAFEQCAGF
LRIPEGKNLFDNTGVHPESYKIAENLLNELNISIKDIKEKKIDKISEKVDIEKLAEKLDC
GIPTLEDIIKELEKPGRDPREDLPKPVLRSDVLELEDLKEGMILKGTVRNIVDFGAFIDI
GVHHDGLAHISEIADRFIKHPLDVISVGDIVDVMVMDIDFDKKRVSLSIKRAK