Protein Info for MMP_RS05755 in Methanococcus maripaludis S2

Annotation: ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00834: Ribul_P_3_epim
  • amino acids 4 to 199 (196 residues), 243.4 bits, E=7.3e-77
• TIGR01163: ribulose-phosphate 3-epimerase
  • amino acids 4 to 212 (209 residues), 253.1 bits, E=8.5e-80

Best Hits

Swiss-Prot: 63% identical to RPE_METJA: Ribulose-phosphate 3-epimerase (rpe) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 100% identity to mmp:MMP1114)

MetaCyc: 40% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• pentose phosphate pathway (5/8 steps found)
• Bifidobacterium shunt (10/15 steps found)
• oxygenic photosynthesis (10/17 steps found)
• superpathway of glucose and xylose degradation (10/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
• heterolactic fermentation (7/18 steps found)
• ethene biosynthesis V (engineered) (12/25 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Sequence Analysis Tools

See Q6LY77 at UniProt or InterPro

Protein Sequence (219 amino acids)

>MMP_RS05755 ribulose-phosphate 3-epimerase (Methanococcus maripaludis S2)
MVMIGASILSADYGHMAEEVKKAEEGNVDFFHVDIMDGHFVPNLSMGLRVPHYLKSITDV
PIDVHLMVENPDLFIPKLADAADMIAFHAESSKYLFRTVDMIKEHDAKPIVALNPSTPIG
NVEYVLENLYGVLVMTVEPGFSGQSFINPMIKKIDNLKNKILTEGYDTKIFVDGGINLET
APKAVEAGADGLIAASAIYGKEDVKKAVNDLRNSANFRI