Protein Info for MMP_RS05750 in Methanococcus maripaludis S2
Annotation: transketolase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to TKTC_METJA: Putative transketolase C-terminal section (MJ0679) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 100% identity to mmp:MMP1113)Predicted SEED Role
"Transketolase, C-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)
MetaCyc Pathways
- formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- pentose phosphate pathway (partial) (3/3 steps found)
- Rubisco shunt (8/10 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- pentose phosphate pathway (5/8 steps found)
- Bifidobacterium shunt (10/15 steps found)
- oxygenic photosynthesis (10/17 steps found)
- superpathway of glucose and xylose degradation (10/17 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
- ethene biosynthesis V (engineered) (12/25 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of ansamycins
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 2.2.1.1
Use Curated BLAST to search for 2.2.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LY78 at UniProt or InterPro
Protein Sequence (312 amino acids)
>MMP_RS05750 transketolase family protein (Methanococcus maripaludis S2) MKGTKKGMREAYGETLAELGEVNENIVVLDADLSGSTKTGIFAKKYPERFFNAGIAEQNM MGMAAGLSRTGKTVFASTFAMFATGRAWEQIRNSIAYPGLNVKICATHSGVTVGEDGASH EMTEDIAIMRAIPKMIVISPSDYLETKSAVRWAADYEGPVYVRMPRGNTEIIFEGEEEAK FEFGKARVLKDGTDITLIATGELVPEALNASKILSEKGISAQVIAIATIKPIDKDAIKNS KDFIVSIEDHSIIGGLGGAISEVIAEDGLNKKLLRVGINDEFGKSGKAGDLLKYYKLDSE SIAETVMNAYKK