Protein Info for MMP_RS05730 in Methanococcus maripaludis S2

Annotation: DUF373 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 173 to 191 (19 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details PF04123: DUF373" amino acids 18 to 347 (330 residues), 281.6 bits, see alignment E=5.6e-88

Best Hits

Swiss-Prot: 58% identical to Y1032_METJA: Uncharacterized protein MJ1032 (MJ1032) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K08975, putative membrane protein (inferred from 100% identity to mmp:MMP1109)

Predicted SEED Role

"Uncharacterized protein MJ1032"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LY82 at UniProt or InterPro

Protein Sequence (369 amino acids)

>MMP_RS05730 DUF373 family protein (Methanococcus maripaludis S2)
MVSIKDIGKDYNVPEDKKYLVIVVDMDDDVGRKANIRTPILSREDNINAAVKLGLTDPGD
SDVNSILGGIQHYDHLKKEGKDVEIATISGDIDIESEVCAIKIKEQIDFLIYLYEPNFIY
LVSDGKEDEMVLKYLELKDIFVWKKRIVIKQNESLESTYYLVQEFIKKTMSQYIPLIFTS
IGFAMILYAVFSDLGWRIIAGLIGIYILSEGVGLVESVKKTLSESKKGLEVGKLSPFGNI
LGFLILLVGILYSYRASVDPELTVFFGKFLLNIANPLTLGFVLLVLVHFIDDLIHTEKSI
LRLLKRLFFNVVLAFMLRQMLIVSSGYLIGYSTEFTGLVMYILAYVSILIVLSVVLFHEP
KSREGLIEE