Protein Info for MMP_RS05650 in Methanococcus maripaludis S2

Annotation: phosphopantetheine adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 4 to 63 (60 residues), 47.5 bits, E=8e-17
• PF01467: CTP_transf_like
  • amino acids 5 to 137 (133 residues), 60.6 bits, E=9.9e-21

Best Hits

Swiss-Prot: 65% identical to COAD_METJA: Phosphopantetheine adenylyltransferase (coaD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02201, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 100% identity to mmp:MMP1093)

Predicted SEED Role

"Phosphopantetheine adenylyltransferase, type II eukaryotic (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (7/9 steps found)
• coenzyme A biosynthesis III (archaea) (3/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

See Q6LY98 at UniProt or InterPro

Protein Sequence (148 amino acids)

>MMP_RS05650 phosphopantetheine adenylyltransferase (Methanococcus maripaludis S2)
MNNVVIGGTFDILHKGHENLLMHASKFGKLFIGITSDDFIKSYKKHDVNPLNVRKNNLKK
FLDTKKIDYEIMVINDVYGDSISEKYDIIVVTPETKENAETINKIRVKNGLKPLIIEIYD
FLMAKDNVPISTTRIRNGEIDTQGNLKR