Protein Info for MMP_RS05640 in Methanococcus maripaludis S2

Annotation: UTP--glucose-1-phosphate uridylyltransferase GalU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01099: UTP--glucose-1-phosphate uridylyltransferase" amino acids 2 to 260 (259 residues), 357.9 bits, see alignment E=1.8e-111 PF00483: NTP_transferase" amino acids 4 to 263 (260 residues), 128.4 bits, see alignment E=3.5e-41 PF12804: NTP_transf_3" amino acids 5 to 157 (153 residues), 37.1 bits, see alignment E=3.7e-13

Best Hits

Swiss-Prot: 67% identical to Y1334_METJA: Putative UTP--glucose-1-phosphate uridylyltransferase (MJ1334) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 100% identity to mmp:MMP1091)

MetaCyc: 44% identical to UTP-glucose-1-phosphate uridylyltransferase (Bacillus subtilis subtilis 168)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYA0 at UniProt or InterPro

Protein Sequence (282 amino acids)

>MMP_RS05640 UTP--glucose-1-phosphate uridylyltransferase GalU (Methanococcus maripaludis S2)
MIKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLANAGIEDILVITGRGKY
AIENHFDKNFELEERLKKDGKCEPLKKILDINEFANIYYTRQGKQNGLGDAVHCGKEFIC
EDYTIVMVGDTIYSGNVPKKLLEAHKKYRCSVIALERVPKEDVYKYGVISGKELENGIFE
INDLVEKPTVEDAPSNLIITGAYLLSSKIFDHLENTQPGRGGEIQLTDAMKSLLKEEKII
GVEVDFKRYDIGDIKGWLEANVELGIENIDGFKEYIRELCDK