Protein Info for MMP_RS05635 in Methanococcus maripaludis S2

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF05368: NmrA" amino acids 2 to 116 (115 residues), 31 bits, see alignment E=8.2e-11 PF04321: RmlD_sub_bind" amino acids 2 to 173 (172 residues), 52.6 bits, see alignment E=1.5e-17 PF01370: Epimerase" amino acids 3 to 230 (228 residues), 212.2 bits, see alignment E=3.1e-66 PF02719: Polysacc_synt_2" amino acids 3 to 251 (249 residues), 51.3 bits, see alignment E=4.1e-17 PF16363: GDP_Man_Dehyd" amino acids 4 to 291 (288 residues), 192.9 bits, see alignment E=4.2e-60 PF01073: 3Beta_HSD" amino acids 4 to 220 (217 residues), 96.8 bits, see alignment E=4.7e-31 PF13460: NAD_binding_10" amino acids 7 to 167 (161 residues), 35.8 bits, see alignment E=3.1e-12 PF07993: NAD_binding_4" amino acids 62 to 215 (154 residues), 37.4 bits, see alignment E=6.8e-13

Best Hits

Swiss-Prot: 72% identical to GALE_METJA: Putative UDP-glucose 4-epimerase (MJ0211) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to mmp:MMP1090)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYA1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>MMP_RS05635 NAD-dependent epimerase/dehydratase family protein (Methanococcus maripaludis S2)
LKILVTGGAGFIGSHIVDMLIENGHDVSILDNLSTGNEKNLNSSAKFINGDILDKNLDLT
GFECVIHEAAQINVRTSVENPSLDANINILGTVNILEKMKEYGVKKIIFSSSGGAVYGEP
EYLPVDEKHSLKPLSPYGLSKFCAEEYIKLYNMLYDIEYCILRYSNVYGERQDPLGEAGV
ISIFIDKMKKGEVPVIYGDGNQTRDFVNVKDVARANLMALNWKNEIVNIGSGKETSVNEL
FKIISSEIGFDKDPIYKKEREGEVYKIYIDYSKAKSLGWMPEVELDDGIKKI