Protein Info for MMP_RS05595 in Methanococcus maripaludis S2

Annotation: imidazole glycerol phosphate synthase subunit HisH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit" amino acids 2 to 200 (199 residues), 247.6 bits, see alignment E=4.8e-78 PF00117: GATase" amino acids 4 to 200 (197 residues), 75.7 bits, see alignment E=6e-25 PF01174: SNO" amino acids 11 to 201 (191 residues), 35.3 bits, see alignment E=1.6e-12 PF07722: Peptidase_C26" amino acids 65 to 185 (121 residues), 20.8 bits, see alignment E=4.4e-08

Best Hits

Swiss-Prot: 100% identical to HIS52_METMP: Imidazole glycerol phosphate synthase subunit HisH 2 (hisH2) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to mmp:MMP1082)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61783 at UniProt or InterPro

Protein Sequence (202 amino acids)

>MMP_RS05595 imidazole glycerol phosphate synthase subunit HisH (Methanococcus maripaludis S2)
MIAIIDYGMGNVGSIKNMIAKIGFDAIITNDPELISKATKLILPGVGSFDSGMTNLKELG
LIDILNKKVVQEKTPLLGICLGMHLLTNSSEEGRLKGLGFINAKTVKFKLSNKFKIPHMG
WNYVKFSIKNKLSDNLIENSRFYFVHSYYVICEDKKNILMTTEYENEFTSAVSKDNIYGV
QFHPEKSHKFGMKLMENFIKQA