Protein Info for MMP_RS05555 in Methanococcus maripaludis S2

Annotation: DUF4040 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details PF13244: MbhD" amino acids 11 to 77 (67 residues), 58.5 bits, see alignment E=3e-20

Best Hits

Swiss-Prot: 63% identical to Y437_METJA: Uncharacterized protein MJ0437 (MJ0437) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14113, energy-converting hydrogenase B subunit D (inferred from 98% identity to mmq:MmarC5_0515)

Predicted SEED Role

"Energy conserving hydrogenase Ehb protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYB7 at UniProt or InterPro

Protein Sequence (80 amino acids)

>MMP_RS05555 DUF4040 domain-containing protein (Methanococcus maripaludis S2)
MSIYIDFLIMALVLMSYIGALIQKDLIKCVVLTGLGGLGLAYLFSSLLAPDVALTEAILG
GAVLPAFFAFTVRRTQRLDE