Protein Info for MMP_RS05435 in Methanococcus maripaludis S2

Annotation: 5'/3'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 3 to 248 (246 residues), 270.1 bits, E=8.7e-85
• PF01975: SurE
  • amino acids 5 to 199 (195 residues), 185.4 bits, E=4.8e-59

Best Hits

Swiss-Prot: 100% identical to SURE_METMP: 5'-nucleotidase SurE (surE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to mmp:MMP1051)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

• UTP and CTP dephosphorylation I (5/7 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• inosine 5'-phosphate degradation (2/4 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (1/3 steps found)
• adenosine nucleotides degradation II (2/5 steps found)
• guanosine nucleotides degradation I (1/4 steps found)
• guanosine nucleotides degradation II (1/4 steps found)
• purine nucleotides degradation II (aerobic) (6/11 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• ureide biosynthesis (2/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (1/6 steps found)
• purine nucleotides degradation I (plants) (4/12 steps found)
• tunicamycin biosynthesis (1/9 steps found)
• NAD salvage (plants) (1/11 steps found)
• superpathway of purines degradation in plants (4/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

See Q6LYE0 at UniProt or InterPro

Protein Sequence (264 amino acids)

>MMP_RS05435 5'/3'-nucleotidase SurE (Methanococcus maripaludis S2)
MTMEILLVNDDGIYSNGLLALKNVICEEFDANVTVVAPTNQQSGIGRAISLFEPLRITKT
KLADCSEGYAVSGTPTDCVVLGVHQVLKKVPDYIISGINIGENLGTEITTSGTLGAAFEG
AHHGAKSFACSLQVTTDHLKFKEGESPIEFMTAARIVKNVFKKFLDDEFPCDVVNINVPD
NATENTPVEITKLAKRMYSMHVEERIDPRSRSYYWLDGYPVMDEEDGTDVYAVRNKRNVS
VTPLTLDNTAKNIDEFKEKYGKKF