Protein Info for MMP_RS05395 in Methanococcus maripaludis S2

Annotation: V-type ATP synthase subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 PF01990: ATP-synt_F" amino acids 3 to 89 (87 residues), 73.3 bits, see alignment E=8.5e-25

Best Hits

Swiss-Prot: 100% identical to VATF_METMP: V-type ATP synthase subunit F (atpF) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02122, V-type H+-transporting ATPase subunit F [EC: 3.6.3.14] (inferred from 100% identity to mmp:MMP1043)

Predicted SEED Role

"V-type ATP synthase subunit F (EC 3.6.3.14)" in subsystem V-Type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYE8 at UniProt or InterPro

Protein Sequence (99 amino acids)

>MMP_RS05395 V-type ATP synthase subunit F (Methanococcus maripaludis S2)
MRIGVVGDPDVVAGFRLAGLTDVYEVNSPEQAAKAIEELNSNSEIGLIITTERIGEKIRD
AISSIKKVVVEVPDKNGPIVRENDPVKVLVRNAVGVDIK