Protein Info for MMP_RS05390 in Methanococcus maripaludis S2

Annotation: V-type ATP synthase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details TIGR02923: ATP synthase A1, C subunit" amino acids 45 to 390 (346 residues), 487.9 bits, see alignment E=9.4e-151 PF01992: vATP-synt_AC39" amino acids 51 to 387 (337 residues), 304.6 bits, see alignment E=5.3e-95

Best Hits

Swiss-Prot: 58% identical to VATC_METJA: V-type ATP synthase subunit C (atpC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02119, V-type H+-transporting ATPase subunit C [EC: 3.6.3.14] (inferred from 100% identity to mmp:MMP1042)

Predicted SEED Role

"V-type ATP synthase subunit C (EC 3.6.3.14)" in subsystem V-Type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYE9 at UniProt or InterPro

Protein Sequence (391 amino acids)

>MMP_RS05390 V-type ATP synthase subunit C (Methanococcus maripaludis S2)
MVDALTQLMELAGMPTDIFMTLFVLAGIAIFLVIMIFLIRYLSETAPFAYVNARVRSMES
RLLKDHKINELIESAGTTELIGFLEDTDYGPYLSEVLGQSEDPVVVEKALDIHLAHVYQT
LANISPDGARKILKLLEKKFDVKNIKTLLRAKYVGLDAEETFKLLIPLGTIPESKLRELS
ETKEIEEIVSALDGTGYSGVLSEGLTEYEQNGKLTTLEMSLDKLILENLWKNVSVDGTEK
DLFKEFIGTMIDIENLKIILKAKADGLSSEVISKYTTSKGYELASWKLKELADVESIEGV
ISSLDGTKYAPIVTENLEEFEKVKSVYVFEKALDSYLVQMGKKLSLRQPFGIGPIIGLIT
SKELEIRNLKIIIKGKIEGLSASEIREILVS