Protein Info for MMP_RS05210 in Methanococcus maripaludis S2

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 2 to 319 (318 residues), 370.1 bits, see alignment E=5.7e-115 PF02885: Glycos_trans_3N" amino acids 2 to 59 (58 residues), 57.9 bits, see alignment E=7.1e-20 PF00591: Glycos_transf_3" amino acids 66 to 310 (245 residues), 249.1 bits, see alignment E=5.5e-78

Best Hits

Swiss-Prot: 100% identical to TRPD_METMP: Anthranilate phosphoribosyltransferase (trpD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 100% identity to mmp:MMP1007)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYI4 at UniProt or InterPro

Protein Sequence (321 amino acids)

>MMP_RS05210 anthranilate phosphoribosyltransferase (Methanococcus maripaludis S2)
MLNKLIERENLSFEESYELFNVLLNESEMRIAAYLVALQTKGLTADEIAGFAKAMRDNAV
KIDLGDVTDTCGTGGDGSKTINVSTAVSIILACFTKVAKHGNVSITSNSGSANVYKALGC
KIPETPDDAKKSMDKTNFAFLFAQKYHPALKKIMPVRNELKVKTIFNILGPLANPANPKY
QILGVNSSELCDNVAIALSKVGGIKKALVVYGNGLDELTPNGTSKITEYDGKFDTYEVTP
KDFGLDYSKIIPCESPDESAKRLIDVFSGKINEDRNFILMNAAAALYTSEIASDFLDGVE
IAKEAIESGKVLKKLEEIRNV