Protein Info for MMP_RS05205 in Methanococcus maripaludis S2

Annotation: anthranilate synthase component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 6 to 129 (124 residues), 64.9 bits, E=9.8e-22
• TIGR01820: anthranilate synthase component I
  • amino acids 9 to 431 (423 residues), 518 bits, E=1.5e-159
• PF00425: Chorismate_bind
  • amino acids 172 to 422 (251 residues), 301.1 bits, E=7.5e-94

Best Hits

Swiss-Prot: 59% identical to TRPE_THEKO: Anthranilate synthase component 1 (trpE) from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 100% identity to mmp:MMP1006)

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• superpathway of chorismate metabolism (25/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

See Q6LYI5 at UniProt or InterPro

Protein Sequence (439 amino acids)

>MMP_RS05205 anthranilate synthase component I (Methanococcus maripaludis S2)
MYKLDYVNPLKLYGVLRDEGKYPVMLESRAKGQVNARYTYISSNPEYMLRIGNKTKMDNE
TISKESNPFKALKENFKVTQKGDRFTGGYVGYIAYDCIHNYIGGKIEEPSVFGYYDHMYV
YDHETNNFYYHSETNNPEELRNAETTVEKAKNFKIEEEDGGIEVLGCDADLDDYVKMVEK
TKEYIYSGDAFQVVPSREYRLKNEFSAFQLYRNLRNVNPSPYMFLLEFDKDVVGASPETM
ASVQNNILKVNPIAGTTAIGKTENETQKLAEALLKDEKERAEHMMLVDLARNDVRKVSKS
GSIVLERFFDVVRYSHVQHIESEVLGTLKDNSTIFDAIEAAFPAGTLTGAPKFRAMEIID
EVEKSRRKIYGGAVGYFSNSGNADLAIGIRMAEIDSVCRVRAGGGVVADSVPENEYYETE
RKMAAMMKALGVRNDSDNR