Protein Info for MMP_RS05200 in Methanococcus maripaludis S2
Annotation: aminodeoxychorismate/anthranilate synthase component II
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 65% identical to TRPG_THEKO: Anthranilate synthase component 2 (trpG) from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 100% identity to mmp:MMP1005)Predicted SEED Role
"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (17/18 steps found)
- superpathway of L-tryptophan biosynthesis (12/13 steps found)
- L-tryptophan biosynthesis (6/6 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (4/4 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- L-glutamine degradation I (1/1 steps found)
- 4-aminobenzoate biosynthesis I (1/2 steps found)
- 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
- L-citrulline biosynthesis (4/8 steps found)
- acridone alkaloid biosynthesis (1/4 steps found)
- L-glutamate and L-glutamine biosynthesis (3/7 steps found)
- superpathway of L-citrulline metabolism (6/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (4/10 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (5/12 steps found)
- superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
- chloramphenicol biosynthesis (1/9 steps found)
- superpathway of candicidin biosynthesis (1/11 steps found)
- superpathway of chorismate metabolism (25/59 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.1.3.27
Use Curated BLAST to search for 4.1.3.27
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LYI6 at UniProt or InterPro
Protein Sequence (198 amino acids)
>MMP_RS05200 aminodeoxychorismate/anthranilate synthase component II (Methanococcus maripaludis S2) MIVIIDNKDSFVWNLADYASIYDSVKVVPNTISIDELKKLNPDGIIISPGPGAPENKRDV ENCPEIIKTMDVPVLGVCLGHQTIAHIFGGKVGRIPPVHGKSSSIKHDSKGIFKNVKNPF TAGRYHSLSVLEVPKNFTVTATTEDGTVMGIRHNDMPIEGVQFHPESVLTEFEEKEGLKI IENFVKFAKTYKSFKKEI