Protein Info for MMP_RS05185 in Methanococcus maripaludis S2

Annotation: tryptophan synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00290: Trp_syntA
  • amino acids 2 to 248 (247 residues), 260.5 bits, E=1.2e-81
• TIGR00262: tryptophan synthase, alpha subunit
  • amino acids 3 to 246 (244 residues), 285.3 bits, E=1.5e-89
• PF00977: His_biosynth
  • amino acids 166 to 224 (59 residues), 27.9 bits, E=1.6e-10

Best Hits

Swiss-Prot: 100% identical to TRPA_METMP: Tryptophan synthase alpha chain (trpA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 100% identity to mmp:MMP1002)

MetaCyc: 50% identical to tryptophan synthase subunit alpha (Thermococcus kodakarensis)
Tryptophan synthase. [EC: 4.2.1.20]; Indole-3-glycerol-phosphate lyase. [EC: 4.2.1.20, 4.1.2.8]

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• DIBOA-glucoside biosynthesis (1/6 steps found)
• superpathway of benzoxazinoid glucosides biosynthesis (1/13 steps found)
• superpathway of chorismate metabolism (25/59 steps found)

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.1.2.8 or 4.2.1.20

Sequence Analysis Tools

See Q6LYI9 at UniProt or InterPro

Protein Sequence (258 amino acids)

>MMP_RS05185 tryptophan synthase subunit alpha (Methanococcus maripaludis S2)
MNKPVLVSFLVSGDPNPDATLKFMKTLDKYSGVIELGIPFSDPVADGPTIQAADVRSLSN
NFKIAKSFEVLKEFRKESDTPVILMTYYNPVYKRGIENFVIQAKEAGANGLIIVDLPLQE
ATEYRKICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLISTFGITGARDTFEQMTFD
FIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAFVDIIKNYGDSKEALVKLE
ELAKELSEGIDKGYEKRK