Protein Info for MMP_RS05160 in Methanococcus maripaludis S2

Annotation: cupredoxin family copper-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13473: Cupredoxin_1" amino acids 11 to 114 (104 residues), 31 bits, see alignment E=2.2e-11 PF00127: Copper-bind" amino acids 41 to 116 (76 residues), 42.3 bits, see alignment E=8.3e-15

Best Hits

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0997)

Predicted SEED Role

"Copper binding protein, plastocyanin/azurin family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYJ4 at UniProt or InterPro

Protein Sequence (118 amino acids)

>MMP_RS05160 cupredoxin family copper-binding protein (Methanococcus maripaludis S2)
VYTYPVLLSVIFMVIFAGCQSEKPLGDSTATFQNETTAVVLIEDFSYKPAFVTVKVGTKV
TWVQKDSVRHTVTSNDGIFDSGLLSEGISWEYTFNEVGMYNYYCIPHPYMKGTVEVVE