Protein Info for MMP_RS05090 in Methanococcus maripaludis S2

Annotation: CO dehydrogenase/CO-methylating acetyl-CoA synthase complex subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR00316: CO dehydrogenase/CO-methylating acetyl-CoA synthase complex, beta subunit" amino acids 1 to 456 (456 residues), 770.2 bits, see alignment E=3.7e-236 PF03598: CdhC" amino acids 5 to 156 (152 residues), 222.6 bits, see alignment E=2.3e-70 PF19436: ACS_CODH_B_C" amino acids 167 to 397 (231 residues), 273.3 bits, see alignment E=2e-85

Best Hits

Swiss-Prot: 68% identical to ACDB_METTH: Acetyl-CoA decarbonylase/synthase complex subunit beta (cdhC) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00193, acetyl-CoA decarbonylase/synthase complex subunit beta [EC: 2.3.1.-] (inferred from 100% identity to mmp:MMP0983)

MetaCyc: 55% identical to acetyl-CoA decarbonylase/synthase complex beta subunit (Methanosarcina thermophila)
2.3.3.M4 [EC: 2.3.3.M4]; 2.3.1.169,2.3.3.M4,2.3.3.M4,2.3.3.M5 [EC: 2.3.3.M4, 2.3.1.169, 2.3.3.M5]

Predicted SEED Role

"CO dehydrogenase/acetyl-CoA synthase subunit beta, acetyl-CoA synthase (EC 2.3.1.169)" in subsystem Carbon monoxide induced hydrogenase (EC 2.3.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.169 or 2.3.3.M4 or 2.3.3.M5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYK8 at UniProt or InterPro

Protein Sequence (457 amino acids)

>MMP_RS05090 CO dehydrogenase/CO-methylating acetyl-CoA synthase complex subunit beta (Methanococcus maripaludis S2)
MFGDIPVEISPMYEGERIRAANMFVELAGPKSVGAELVLVSDDVEDGKIEVIGPELKDME
EGKKYPFGILMEVSGEKLEKDLEGVIERRIHEICNYVQGFMHLNQRDKIWCRIGKDSHAK
GFELKHLGQALSTLFKDEFPIIEAISITIFTEEEKVKEFVEKAVSEYQARDSKARDLSEE
DVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAAKIDPEGPIFEIPKGDLLD
PVSGEYTTLNATVADKSQSTFDKVYLHSIFGHPHTSCGCFEAVAFYIPEVDGIGIVHRDF
KGDTPMGIPFSAMAGQCSGGKQVEGFAGLCVEYMRSPKFLQADGGYERIVWLPKEIKEKV
LESIPEELRDKIATEEDVSSIHNLKKFLNEKDHPVLKRIAELDAPFEEQVVETEAEPAGE
FVQFAQIPEMAIPTSGGIKIILKNAKIYAEKIIIKKK