Protein Info for MMP_RS05085 in Methanococcus maripaludis S2

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF02374: ArsA_ATPase" amino acids 2 to 134 (133 residues), 38.1 bits, see alignment E=3.4e-13 PF06564: CBP_BcsQ" amino acids 2 to 157 (156 residues), 22.9 bits, see alignment E=1.7e-08 PF10609: ParA" amino acids 2 to 248 (247 residues), 34.9 bits, see alignment E=3.5e-12 PF01656: CbiA" amino acids 2 to 228 (227 residues), 70.5 bits, see alignment E=4e-23 PF13614: AAA_31" amino acids 3 to 168 (166 residues), 58.9 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 57% identical to Y685_METJA: Uncharacterized ATP-binding protein MJ0685 (MJ0685) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07321, CO dehydrogenase maturation factor (inferred from 99% identity to mmx:MmarC6_1676)

Predicted SEED Role

"CO dehydrogenase accessory protein CooC (nickel insertion)" in subsystem Carbon monoxide induced hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYK9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>MMP_RS05085 AAA family ATPase (Methanococcus maripaludis S2)
MIIAVTGKGGVGKTLLSSLIIRNLTKSGKNILAIDADPDSNLPEALGVEVTKTVGDAREE
LKKEVKSGNTSPEMDMWNSLDYKIMESIIETPEFDLLVMGRPEGSGCYCAVNNMLRKIIE
TVSSNYDIVVIDTEAGLEHLSRRTTQNVDTLLVVTDSSKRGILTASRIKELAKELDISFK
NLYLVLNRIKPENEENVRETVKDFGLDIIGIIYDDELTASYDMEGKPLFELPDDSETVNS
VSKIVEKILG