Protein Info for MMP_RS05075 in Methanococcus maripaludis S2
Annotation: acetyl-CoA decarbonylase/synthase complex subunit gamma
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to ACDG_METTH: Acetyl-CoA decarbonylase/synthase complex subunit gamma (cdhE) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
KEGG orthology group: K00197, acetyl-CoA decarbonylase/synthase complex subunit gamma [EC: 2.1.1.-] (inferred from 100% identity to mmp:MMP0980)MetaCyc: 42% identical to acetyl-CoA decarbonylase/synthase complex gamma subunit (Methanosarcina thermophila)
2.1.1.245,2.3.3.M4 [EC: 2.1.1.245, 2.3.3.M4]
Predicted SEED Role
"5-tetrahydromethanopterin:corrinoid iron-sulfur protein methyltransferase / CO dehydrogenase/acetyl-CoA synthase subunit gamma, corrinoid iron-sulfur subcomplex large subunit" in subsystem Carbon monoxide induced hydrogenase
MetaCyc Pathways
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
- reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
- carbon tetrachloride degradation II (4/6 steps found)
- methanogenesis from acetate (4/6 steps found)
- hydrogen production VI (1/2 steps found)
- methoxylated aromatic compound degradation II (6/9 steps found)
- superpathway of methanogenesis (11/21 steps found)
- reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.- or 2.1.1.245 or 2.3.3.M4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LYL1 at UniProt or InterPro
Protein Sequence (457 amino acids)
>MMP_RS05075 acetyl-CoA decarbonylase/synthase complex subunit gamma (Methanococcus maripaludis S2) VKVTAMDIYKLLPKTNCGKCGEASCMAFAAKLSQKEAELSACPQLKGADFEKLANMLAPA VREIKIGTGDRAVTIGGDEVLYRYELTYYNPTAVAVDLSDDMDDSAFDQKLVKIKNLEFE RTGEILKLNAVALRNKSGDAEKFKKAAEKLKDSEIPVILCSFDPKAMDAALDVIGSKRPL IYAATENNIDEMSELALKHNCPISLFVPNDLEKMKQLSRKLRESGVKDIVLDPGTYIGEA IGDTMDNFIMIRRLAVEEKDDDFRFPILAVPAVCWINPEEDEILTKMKEATTAAALMNRY ADVMILHGVDIWEMMPVLTLRQSLYTDPRKPQSVEAKIYEFGTVDENSPVIMTTNFALTY YTVAGDLKSGKVNCYLLVLDTNGKAVDVAVAGGQFNGKAAAELMKETGIEKLVNHKKLII PGLAASVSGDIEDQSGWEVIVGTRDSSEVPAFLAKIW