Protein Info for MMP_RS04990 in Methanococcus maripaludis S2

Annotation: aquaporin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 67 (19 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details PF00230: MIP" amino acids 2 to 233 (232 residues), 169.7 bits, see alignment E=4.2e-54 TIGR00861: MIP family channel proteins" amino acids 9 to 233 (225 residues), 195.3 bits, see alignment E=6.2e-62

Best Hits

Swiss-Prot: 70% identical to AQPM_ARCFU: Probable aquaporin AqpM (aqpM) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 100% identity to mmp:MMP0963)

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYM7 at UniProt or InterPro

Protein Sequence (239 amino acids)

>MMP_RS04990 aquaporin family protein (Methanococcus maripaludis S2)
MSMIKKLIAECLGTGILVFFGPGAAAMTLMIANNTGTAGIGLLGGLGDWFAIGFSFAIAI
AAVIYTMGRISGAHINPAVTIGLWAVKKFPTKDTVLYIIAQLIGAAIGSLLFFACIGIDS
VTIGGLGATAPFAGISYFQAILAEFIGTFLLMFVIMGVAVDKRAPDGFAGLVIGLTVGAI
ITTTGNIAGASLNPARTFGPYLIDSIYGLNLWYYFPIYIIGPVLGAIVAAFTYEYLNRE