Protein Info for MMP_RS04895 in Methanococcus maripaludis S2

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 272 (25 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 12 to 325 (314 residues), 160.6 bits, see alignment E=3.3e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0944)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYP4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>MMP_RS04895 AI-2E family transporter (Methanococcus maripaludis S2)
MKENEYRFLMRIFVLISFLSVMIIAFPFLDTIAFACAFAYMTEPFFSALKKYTGRTLGAI
LCILMITVPAIILVFLILTDIFEFLNSLDYAGFVDYTVQFINYIGLQNIAKEDLSSILSE
IWNFLKPTVNKMAGQIYGLPLLFIKGLVTVFLTYYFLKDGYRFKDAVMPHVPEVYHVQTE
LFIRKLHEAYKNLFVVNALTAFTVGLISIAGFWAIGLPNPVTLGALSGILTLLPIVGGWT
IYMPLSVYYIAVGMYSKAILLFGFGVLFLSLAPDFVIRPRLVNHESSIHPAFALVAFLMG
PLALGITGFALGPLIMGTFDAIFRVKNGKDSIINLK