Protein Info for MMP_RS04885 in Methanococcus maripaludis S2

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 143 to 176 (34 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details PF01925: TauE" amino acids 10 to 268 (259 residues), 173 bits, see alignment E=4.4e-55

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to mmp:MMP0942)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYP6 at UniProt or InterPro

Protein Sequence (270 amino acids)

>MMP_RS04885 sulfite exporter TauE/SafE family protein (Methanococcus maripaludis S2)
MEIFLIYLLLLVVGCIVGFTTGALGLGGGFLMVPILIYLFQNLGISDDYVVAMAVGTSLS
VIFLTSLNSAYSHSKFGNIIWKYSLLLGFSGIMGTFVGVQIVTKYLSGDLHRMLFGIMLI
ILSLNMALSKSDPKLENSQEIKYLPVIFCGFLIGILSSMFGIGGGTIAIPILTIFLKTPI
KKSIGTSLGMMVIISLSGSLGYFTNSVAIPQAYNYLNFIGYVSLTSVLSIGVMSIIFSRY
GAKLSNRINAGLLKKFFGIILMFVGLTMII