Protein Info for MMP_RS04880 in Methanococcus maripaludis S2

Annotation: phosphoadenosine phosphosulfate reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 TIGR00451: uncharacterized domain 2" amino acids 88 to 207 (120 residues), 51.9 bits, see alignment E=3.8e-18 PF01472: PUA" amino acids 129 to 208 (80 residues), 41.7 bits, see alignment E=8.9e-15 PF01507: PAPS_reduct" amino acids 262 to 438 (177 residues), 150.6 bits, see alignment E=4.7e-48

Best Hits

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 100% identity to mmp:MMP0941)

Predicted SEED Role

"PUA-PAPS reductase like fusion"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYP7 at UniProt or InterPro

Protein Sequence (503 amino acids)

>MMP_RS04880 phosphoadenosine phosphosulfate reductase family protein (Methanococcus maripaludis S2)
LKTILGKIHLKWCKNCNLPVLDTKCAICDSETVEVKVTPPGDARPAFKGDLDLINKTINL
QFGIEENLFKNKLVLVNKAPGIEYFQEIIVDGIIFGILNFNEKKHEWKIIPTIEGARRLI
VAGCKKKLLVVKEDVPKFILNKGASVLRPGVDYASEDITKDDDVIILIEKPDSSQNFNEM
DVLGVGRARMDYEQIINSEKGMVAKVRKSELPKNSEILHEVGEFDEAIEKMICANKNAME
KVERNSIGFMRNTVVKIGKPASVAYSGGKDSLAVLLLALEAFKNTEDPIEFDVLFNDTGI
EFNETLENIEKIANTYDLEILKTKSGDFWEKLEEYGPPGRDNRWCSEVCKVSPLGKLIDE
KYEKGCLSFVGLRKYESINRSKKPRIWNSPTIKKQMLSAPILNWTAMHVWIYILKHKAPY
NVLYEQCFDRVGCFMCPAMEIGEIELVKLSYPELWEKWESFLKSHAKIHEKSEDWVKGGW
RWTNKTRTNNQKPDEPINENWLG