Protein Info for MMP_RS04825 in Methanococcus maripaludis S2

Annotation: protein-glutamate O-methyltransferase CheR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF03705: CheR_N" amino acids 6 to 56 (51 residues), 45.1 bits, see alignment 6.6e-16 PF01739: CheR" amino acids 69 to 260 (192 residues), 189.9 bits, see alignment E=3.6e-60

Best Hits

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to mmp:MMP0930)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYQ8 at UniProt or InterPro

Protein Sequence (270 amino acids)

>MMP_RS04825 protein-glutamate O-methyltransferase CheR (Methanococcus maripaludis S2)
MDDMYFKRIKRDIGTKLKIQVDQYKDTYILRRVSVRMRLCKCKDFKEYYEYLTKNPSEYE
KLENTLTVNVTEFWRDRTVYNELRNVFEKMVTDRTVRSIRIWSAGCSSGEEPYGLAVMIK
ELMEKHNQKFLRVLITATDLDKEILERAKEGTYISKQFKNMDQDVIDKYFDKLNDKEYQI
KKEIKRMVQFKKHDLIKEGPMKDMNMVLCRNVIIYFEKDIQEKLFMKFHEALNDGGYLVL
GKTEMLHGDSRNAFKPSNHRERIYQKLKIN