Protein Info for MMP_RS04815 in Methanococcus maripaludis S2

Annotation: chemotaxis protein CheD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF03975: CheD" amino acids 45 to 147 (103 residues), 116.5 bits, see alignment E=3.3e-38

Best Hits

Swiss-Prot: 100% identical to CHED_METMP: Probable chemoreceptor glutamine deamidase CheD (cheD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 100% identity to mmp:MMP0928)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYR0 at UniProt or InterPro

Protein Sequence (154 amino acids)

>MMP_RS04815 chemotaxis protein CheD (Methanococcus maripaludis S2)
MVLKVKMGDIGVAKSPESIETLLGSCVAIILYDRGKKIGGVAHVMLPKSRNSSEKNPGKY
ANTAIPELINRMAKLGARKDKLTTKLAGGAAMFKCNSNTIDVGKKNIEASREEVKKMGLR
IASEDLGGDTGRTITLSLKDGSVLVRTGSELKTI