Protein Info for MMP_RS04805 in Methanococcus maripaludis S2

Annotation: chemotaxis response regulator protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF00072: Response_reg" amino acids 6 to 111 (106 residues), 86.5 bits, see alignment E=1.5e-28 PF01339: CheB_methylest" amino acids 177 to 355 (179 residues), 198.1 bits, see alignment E=9.8e-63

Best Hits

Swiss-Prot: 100% identical to CHEB_METMP: Protein-glutamate methylesterase/protein-glutamine glutaminase (cheB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to mmp:MMP0926)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62647 at UniProt or InterPro

Protein Sequence (365 amino acids)

>MMP_RS04805 chemotaxis response regulator protein-glutamate methylesterase (Methanococcus maripaludis S2)
MSKIKVLIVDDSAFMRKVLEDILKSDDEIEVVATAKDGKEAFELVKKLEPNVITMDVEMP
IMNGIDATKQIMAYKPTPILMLSAVTKQGSEATLKALDNGAVDFIEKPSGSVSLDIRKIG
EKIIKQVKDASKSKVRIKSSRILENIKKEKQDESSTPKPQVEKTSGLSPEKLNDTAILIG
SSTGGPPVVSSIISNIPKNTPPIFIVQHMPKGFTRVFAERMNNNSAITVKEAEHGEIVKP
DHAYVAPGDSQMVLQKRGGNVYIIIDENMPKIHGTKPTVDVTAEYVTKYYGKNTIGVLLT
GIGRDGANGLKMVKNKGGYTIAQNQDTCVIYGMPKTAIEMNVVDKVMDPIDIPLEIIKFA
KKIGG