Protein Info for MMP_RS04685 in Methanococcus maripaludis S2

Annotation: DUF126 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF01989: AcnX_swivel_put" amino acids 25 to 102 (78 residues), 89.1 bits, see alignment E=6.6e-30

Best Hits

Swiss-Prot: 73% identical to Y1407_METJA: UPF0107 protein MJ1407 (MJ1407) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K09128, hypothetical protein (inferred from 99% identity to mmp:MMP0902)

Predicted SEED Role

"Aconitate hydratase X, predicted" in subsystem TCA Cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYT5 at UniProt or InterPro

Protein Sequence (130 amino acids)

>MMP_RS04685 DUF126 domain-containing protein (Methanococcus maripaludis S2)
LKELNGRIISKGVVEGEAIISKSPISFLGGVNEEGIVTDKENELFGKSIANKIFVFPSGK
GSTVGSYVIYGLAKRGLLKGMVNFESEPIVATGAILGKIPLVDKVNIDEIKDGDIVVVDG
NTGTVKIKEQ