Protein Info for MMP_RS04670 in Methanococcus maripaludis S2

Annotation: selenouridine synthase SelU-like subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR04569: selenouridine synthase, SelU C-terminal-like subunit" amino acids 1 to 217 (217 residues), 412.3 bits, see alignment E=2.5e-128 PF26341: AAA_SelU" amino acids 6 to 125 (120 residues), 61.7 bits, see alignment E=4e-21

Best Hits

Swiss-Prot: 58% identical to Y053_METJA: Uncharacterized protein MJ0053 (MJ0053) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0899)

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYT8 at UniProt or InterPro

Protein Sequence (219 amino acids)

>MMP_RS04670 selenouridine synthase SelU-like subunit (Methanococcus maripaludis S2)
MIIFGLFGKTGCGKTEILDELKKKYTVVDIEGCANNKGSILGDLYDLSSSTQEKFDTCLE
EQKKIAESTGYCIVEFEGKKIGGRTKVTIPEPFSDLKCYNYNIVVNCPYECQIKRLLNWY
RPKNESEKEILIDKFVDLKTVLSKPEKIELMDKIIDLIKKDEYYDAAILIEDGLYSEHYL
RHIGKVKHDLIINNEDNLKSAEEISRYIDEILKKHGIKN