Protein Info for MMP_RS04640 in Methanococcus maripaludis S2

Annotation: CTP synthase (glutamine hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 1 to 529 (529 residues), 868.2 bits, E=1e-265
• PF06418: CTP_synth_N
  • amino acids 2 to 264 (263 residues), 435.4 bits, E=1.2e-134
• PF00117: GATase
  • amino acids 299 to 528 (230 residues), 134.4 bits, E=6e-43
• PF07722: Peptidase_C26
  • amino acids 370 to 511 (142 residues), 24.8 bits, E=2.6e-09

Best Hits

Swiss-Prot: 100% identical to PYRG_METMP: CTP synthase (pyrG) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to mmp:MMP0893)

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See Q6LYU4 at UniProt or InterPro

Protein Sequence (533 amino acids)

>MMP_RS04640 CTP synthase (glutamine hydrolyzing) (Methanococcus maripaludis S2)
MKYIFVTGGVVSSLGKGITSSSLGRLLKARGLNVNMIKIDPYLQIDAGTMSPFEHGEVFV
TDDGGETDLDLGNYERFVDIGLKADNNITTGKIYWSVLSKERKGDYLGKTVQVIPHITNE
IKDRIKNLGKESDITIIEIGGTVGDIESLPFLEAIRQFKKDVGKENVLYIHVSLLPYIRS
AGELKTKPTQHSVKELKGIGIQPDILVCRSEIPISEKIKDKLALFCDVEKEAVIECKDAR
TIYEVPLNLEKEGLGKLVTEKLNLRDSTPDLTEWRAIVDRIINPMNEITIGIVGKYIELK
DSYMSIMEALGHAGAKNDTKVNIAWINSEELETKNYEEILNKMVDDEKLHGILVPGGFGD
RGIDGKVNAVRYAREKNIPFLGICLGMQCAVIEFARHVCGLNANSTEFDEETEHPVIDYI
PEQREVTEKGGTMRLGAYPAVLTENSLASELYGSINASERHRHRYEVNPEYHEILKKNGL
IISGMSPDGKLAEFIELENHKYFIATQAHPEFKSRPNKPHPLFHGLVKASIEK