Protein Info for MMP_RS04635 in Methanococcus maripaludis S2

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF13302: Acetyltransf_3" amino acids 10 to 150 (141 residues), 80.6 bits, see alignment E=2.7e-26 PF13420: Acetyltransf_4" amino acids 12 to 168 (157 residues), 34 bits, see alignment E=4.5e-12 PF00583: Acetyltransf_1" amino acids 67 to 147 (81 residues), 30.4 bits, see alignment E=6.1e-11

Best Hits

KEGG orthology group: K03817, ribosomal-protein-serine acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to mmp:MMP0892)

Predicted SEED Role

"Ribosomal-protein-L7p-serine acetyltransferase" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYU5 at UniProt or InterPro

Protein Sequence (182 amino acids)

>MMP_RS04635 GNAT family N-acetyltransferase (Methanococcus maripaludis S2)
MVELKVDSEIVLKEIELSDAEDIFKLIDSDRKNLRTWLSFIDSTKEIEDTKDFIRSILFL
PKDIRDLVTVIIYNEQKIGLIGFKLTDFVNKKTEIGYWISKEFENKGIVTKSVVKMIDYA
FNTLNLNRIQIKCGIGNEKSSKIPKKLNFKFEGIERSAELLNGKFIDAEVYSILKDEWTF
KN