Protein Info for MMP_RS04625 in Methanococcus maripaludis S2

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 PF04851: ResIII" amino acids 14 to 177 (164 residues), 49.2 bits, see alignment E=1.8e-16 PF00270: DEAD" amino acids 17 to 182 (166 residues), 116.2 bits, see alignment E=4.1e-37 PF22527: DEXQc_Suv3" amino acids 64 to 175 (112 residues), 30.2 bits, see alignment E=9.2e-11 PF00271: Helicase_C" amino acids 236 to 379 (144 residues), 32.9 bits, see alignment E=2e-11 PF20470: HTH_61" amino acids 384 to 476 (93 residues), 25.4 bits, see alignment E=4.5e-09 PF21280: Helicase_dom4_arc" amino acids 563 to 678 (116 residues), 91 bits, see alignment E=1.7e-29

Best Hits

Swiss-Prot: 74% identical to HELS_METVS: ATP-dependent DNA helicase Hel308 (hel308) from Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)

KEGG orthology group: K03726, helicase [EC: 3.6.4.-] (inferred from 100% identity to mmp:MMP0890)

Predicted SEED Role

"Putative ski2-type helicase MJ1124"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYU7 at UniProt or InterPro

Protein Sequence (747 amino acids)

>MMP_RS04625 DEAD/DEAH box helicase (Methanococcus maripaludis S2)
MHVLDILKENKITELRPPQKKVIDEGLFDKTKNFLICIPTASGKTLIGEMALLNHILDEN
KNLTGKKGLFIVPLKALANEKFDEFKEKYEKYGIKVGLSIGDFDTKENLSKFHIIITTSE
KLDSLMRHEVEWINDVSLAVIDEIHLIGDNDRGGTLEVILTKLKNLNAQIVGLSATIGNP
EELSNWLNAKLIVDEWRPVELKKGIYFENELEFVKSPAKKIKQVSKNNITDLIVDSVEEK
GSCLIFCNSKRNAVGEAKKHNLTKYLTRTEQHELNKLSEEILSILDTPTETCKALSECIK
KGIAFHHAGLTYQHRKIVEDGFRNRLIKVICCTPTLSAGLNLPCRRAIVRDIKRYSQNGL
VDIPRMEIQQCIGRAGRPGLDPYGEGIIYIKNEKEIEKAYEILTGSVENIYSKLANQKVL
RIHILGLISTGEIKDGQNLVNFMKNTFYAYQFGNIGAVLLNVSEVVKFLEKNKFLETSVL
KKTENTVRELSFDSSNNLVLDSKETSFDLANPDSKVEFRSTKLGKRISELYIDPMSSEII
IEELYELKKKCAQLDRSKIDQSLFYLISKTNEMRPLLRVRANEELDLILKMDKMGLKDYS
AENIEAFKNSKMFCDWVSEIPEEIILEKYGVEPGILRYKVEQAKWMIYSTKEIAKLINLD
SSAIYRALMEMELRIEYGAKEELIELLKVKNIGRSRSRKLYNAGIRSKIEINNNPEKIFE
LFGEKIGKKILGELGMKYGQQTLLNFN