Protein Info for MMP_RS04605 in Methanococcus maripaludis S2

Annotation: cobalt ECF transporter T component CbiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 27 to 58 (32 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details PF02361: CbiQ" amino acids 15 to 225 (211 residues), 144.7 bits, see alignment E=1.6e-46 TIGR02454: cobalt ECF transporter T component CbiQ" amino acids 21 to 218 (198 residues), 193 bits, see alignment E=2.5e-61

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to mmp:MMP0886)

Predicted SEED Role

"Transmembrane component NikQ of energizing module of nickel ECF transporter" in subsystem ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYV1 at UniProt or InterPro

Protein Sequence (255 amino acids)

>MMP_RS04605 cobalt ECF transporter T component CbiQ (Methanococcus maripaludis S2)
LHGSIHSLERDAFVESPLHRIDARIKLIFVFTVVLTATIFNNVYLMVLMEIYMLFVMLFS
KIPISNLLKRIIMIIPFGGFIALFQPFIRGESVIYYLGMLPIYSEGLDFGMSLFLKFLVS
ITSVVLLSSTTPMYEVINAGKKLGIPSIMSTLLGMMIRYLFVMVDVLESTIKAQKSRALN
RKNLNYKQLLNTFGSLIGLVFLKSYEQGERTYLGMLSRGYSKDSNIKTLGQKIGVNDVLF
LSTTTLILSIGIISF