Protein Info for MMP_RS04560 in Methanococcus maripaludis S2

Annotation: carboxylating nicotinate-nucleotide diphosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 10 to 277 (268 residues), 278.6 bits, see alignment E=2.3e-87 PF02749: QRPTase_N" amino acids 22 to 103 (82 residues), 68.2 bits, see alignment E=5.9e-23 PF01729: QRPTase_C" amino acids 105 to 277 (173 residues), 194.1 bits, see alignment E=1.6e-61

Best Hits

Swiss-Prot: 58% identical to NADC_METJA: Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 100% identity to mmp:MMP0877)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYV8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>MMP_RS04560 carboxylating nicotinate-nucleotide diphosphorylase (Methanococcus maripaludis S2)
VLKNHALRILEESLDYDVGFGDLTTELMIPKNQESEAVFIAKEKAIICGIDFVIEFMEKN
GLTCTSLVNEGDNVIGPFLKVKGNTKTIITLERTALNFLMHLSGISTKTNRIINEVRKIN
KTVKIAATRKTHPLLSMIEKYAVFVGGGDTHRFRLDDMVMIKDNHIQAVGIEECFKRAEK
LSFSKKIEVEVDTLDQLKEVIEYKPDIILLDNFEFKNIETALNIVSEFEKKTGFKPKIEL
SGGINENNVENYAKYNVDVISMGSLIHSATSVDIGLDLL