Protein Info for MMP_RS04550 in Methanococcus maripaludis S2

Annotation: S-layer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01564: S-layer protein" amino acids 6 to 533 (528 residues), 320.9 bits, see alignment E=8.4e-100 PF05124: S_layer_C" amino acids 34 to 533 (500 residues), 213.2 bits, see alignment E=2.3e-67 PF05123: S_layer_N" amino acids 111 to 441 (331 residues), 230.2 bits, see alignment E=4.8e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0875)

Predicted SEED Role

"S layer protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYW0 at UniProt or InterPro

Protein Sequence (533 amino acids)

>MMP_RS04550 S-layer protein (Methanococcus maripaludis S2)
MAISIKKIVSIGLGGLMLGSTFCSGAFAVEKVGDVDSFVSDIVSGNNSNIDIIVGSNSVA
SDVVSAANIAAKIGSLSFLEQNGKSAAATLSIASKSKSEEFNLIGSGVTDSLFAVSADDD
YLSIITNADFHSSTNLDATGYVSLEDLGNLMEISDTDPSSWFTGSDNDVSAEFLFLRLKS
DATNWKVNSDEMSYMALLLDENLGVPGGLKCMSPGRNIVYLGEEWTLMGMNADADKVSMG
KEVYRGTLKEGKSYFVNGYEIKIDSIITDSTNYKVSAKILKDGTVVKSAYDTAPLNLISN
GIGIRFQKVYESIDSNAAYADVVIVNSVKGMELGSEVIPDYEIYSVLYTGGTFRYTDDFL
KGQKNMGLALKYVGDDLTGLGSDDTVEIANYANFLFDDEGKSATTLSVFFEMNEEKEVSI
IQNQKAKVLNVEVIADKISAESEQSTILNAPVVKLDTETSMESSENPLILVGGPVVNSIT
EELVNAGLFAIDDDSLATLAVVSETANGNDVLIVTGGDRDATAEAANALIAMI