Protein Info for MMP_RS04525 in Methanococcus maripaludis S2

Annotation: D-2-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00018, glycerate dehydrogenase [EC: 1.1.1.29] (inferred from 100% identity to mmp:MMP0870)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

L-serine biosynthesis I (3/3 steps found)
superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (4/9 steps found)
photorespiration II (3/10 steps found)
photorespiration I (2/9 steps found)
photorespiration III (2/9 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.29 or 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYW5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>MMP_RS04525 D-2-hydroxyacid dehydrogenase (Methanococcus maripaludis S2)
MKIVVLDGYAMNSGDLSWEDLKKLGELSIYDRTLESEVVERISDSEIVITNKVIIGKEVL
EKCKNIKYVGVTATGYNVVDTTLAKDHGVIVTNVPAYSTDSVAQLVFSFILEHCQNVSKY
TESVKSGDWVNSKDFSYQKFPIIELAGKSLGIIGFGAIGKKVAEIGNAFGMNVLVNTRTV
SKTDEINVNFVSKEEIFKNSDFLTLHCPLNNETDKIVNEKTLNLMKKSAILINTGRGGLV
NEKDLANALNLEKIAGAGLDVLSTEPPKEDNPLLNAKNTYITPHVAWASYEARKRLMDVT
INNVKSFIDGNPINVVNK