Protein Info for MMP_RS04510 in Methanococcus maripaludis S2

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 137 to 164 (28 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 272 (165 residues), 96.5 bits, see alignment E=8.2e-32

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to mmp:MMP0867)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LYW8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>MMP_RS04510 ABC transporter permease subunit (Methanococcus maripaludis S2)
LADTFNLGIGKFLVNLIDFLIDNYSGFFDLISYVIQSGVDFFHFLLFSINPYLMILLIAV
IVWKTVNLKSMLYSVFFLVIIVMMGLWDTSMITLSLIITSTLIALLLGIPLGIVKARSKL
VSTLLDPMLDVMQTLPSLAYLIPAVLFFGIGEVPGVIATVIFAMPPAIKLTALGIEQVSN
ELIEVGRAFGGTSWQILTKIELPTAVPSIMMGVNQAIMLSFSMVVIAGFIGSGGLGEVII
SGIQRYSLAPALEAGIAVTFLAVIFDRITRNLVGSKI