Protein Info for MMP_RS04465 in Methanococcus maripaludis S2

Annotation: nitrogenase iron-molybdenum cofactor biosynthesis protein NifE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR01283: nitrogenase MoFe cofactor biosynthesis protein NifE" amino acids 26 to 480 (455 residues), 705.6 bits, see alignment E=1.2e-216 PF00148: Oxidored_nitro" amino acids 74 to 470 (397 residues), 412.8 bits, see alignment E=7.4e-128

Best Hits

Swiss-Prot: 100% identical to NIFE_METMP: Nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (nifE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02587, nitrogenase molybdenum-cofactor synthesis protein NifE (inferred from 100% identity to mmp:MMP0858)

MetaCyc: 37% identical to Nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (Azotobacter vinelandii)
RXN-17026

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifE" in subsystem Nitrogen fixation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CW55 at UniProt or InterPro

Protein Sequence (480 amino acids)

>MMP_RS04465 nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (Methanococcus maripaludis S2)
MVLNLDTENRKMQDGNNDDDFDLEVKIPNSIFEKLKSIEALKARESQMCVSGKDDSIPTC
DKNSTPGMITQRSCVYGGARVVLMPITDAVHLVHGPIGCAACTWDIRGSKSTGDKLYKNG
FSTDLQEKDIVFGGEKKLYESILEVNKLYHPGAIFVYSTCVVGLIGDDLKAVCRQAQEAT
GCRVIPVQSEGFKSFNKTAGHKLACDAMLDYVIGTEEPEEEHPYSINIIGEFNVAGDLWG
IIPLYEKMGVKVHTAITGDSTVAKVASAHRSKLNIVQCQKSSNYLAAQMEKKYGIPSIKV
NFFGLDETTKSLRAVAEFFGDEEMIKRTEELIKSEIKNLRDEISEYKKDLSGRTVAIYSG
AHKSWALVSAFGELDMEIIMSGTQNGKPEDYQQIRDHVCEGTLIVDDASSMELVQLLKEY
KPDILISGAKEKYLSLKSGIPHCDFNHDRITAFSGYQGFINFARVVHTAVMTPIWRLSRK