Protein Info for MMP_RS04440 in Methanococcus maripaludis S2

Annotation: nitrogenase iron protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR01287: nitrogenase iron protein" amino acids 3 to 273 (271 residues), 459.9 bits, see alignment E=1.4e-142 PF00142: Fer4_NifH" amino acids 3 to 272 (270 residues), 397.1 bits, see alignment E=4.3e-123 PF01656: CbiA" amino acids 6 to 225 (220 residues), 36 bits, see alignment E=6.3e-13

Best Hits

Swiss-Prot: 100% identical to NIFH_METMP: Nitrogenase iron protein (nifH) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02588, nitrogenase iron protein NifH [EC: 1.18.6.1] (inferred from 100% identity to mmq:MmarC5_0658)

MetaCyc: 73% identical to [FeFe]-nitrogenase complex nitrogenase reductase component monomer (Azotobacter vinelandii)

Predicted SEED Role

"Nitrogenase (molybdenum-iron) reductase and maturation protein NifH" in subsystem Nitrogen fixation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CW57 at UniProt or InterPro

Protein Sequence (275 amino acids)

>MMP_RS04440 nitrogenase iron protein (Methanococcus maripaludis S2)
MVRKIAIYGKGGIGKSTTTQNTVAAMAHFHDKKVFIHGCDPKADSTRLILHGKQQVTMMD
TLREKGEDECTPDKVIEVGFGGVKCVESGGPEPGVGCAGRGVITAITLMEQHGVYEDDLD
FVFFDVLGDVVCGGFAMPVRDGKADEIYVVASGEMMALYAANNICKGMVKYAEQSGVRLG
GIICNSRNVDGELDLLQEFCDKIGTQLIHFVPRDNIVQKAEFQKKAVVDYDDTCNQALEY
KELARKIIENENLVIPTPMTMDELEELTSKYGFLD