Protein Info for MMP_RS04295 in Methanococcus maripaludis S2

Annotation: CoB--CoM heterodisulfide reductase iron-sulfur subunit A family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 PF00890: FAD_binding_2" amino acids 147 to 181 (35 residues), 24 bits, see alignment (E = 1.6e-08) PF13450: NAD_binding_8" amino acids 148 to 184 (37 residues), 23.5 bits, see alignment 4.3e-08 PF00037: Fer4" amino acids 241 to 258 (18 residues), 26.9 bits, see alignment (E = 2.4e-09) amino acids 286 to 308 (23 residues), 23.3 bits, see alignment (E = 3.3e-08) amino acids 577 to 599 (23 residues), 24.4 bits, see alignment (E = 1.4e-08) PF12800: Fer4_4" amino acids 244 to 257 (14 residues), 18.4 bits, see alignment (E = 1.6e-06) amino acids 291 to 304 (14 residues), 12.2 bits, see alignment (E = 0.00016) amino acids 616 to 630 (15 residues), 11.2 bits, see alignment (E = 0.00035) PF12838: Fer4_7" amino acids 245 to 303 (59 residues), 27.1 bits, see alignment 3.5e-09 amino acids 584 to 631 (48 residues), 29.1 bits, see alignment 8.2e-10 PF13187: Fer4_9" amino acids 245 to 308 (64 residues), 33.8 bits, see alignment E=2e-11 amino acids 584 to 631 (48 residues), 29.4 bits, see alignment 5e-10

Best Hits

Swiss-Prot: 74% identical to HDRA2_METKA: CoB--CoM heterodisulfide reductase iron-sulfur subunit A 2 (hdrA2) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

KEGG orthology group: K03388, heterodisulfide reductase subunit A [EC: 1.8.98.1] (inferred from 100% identity to mmp:MMP0825)

MetaCyc: 69% identical to H(2):CoB-CoM heterodisulfide,ferredoxin reductase alpha component monomer (Methanothermobacter thermautotrophicus)
RXN-18521 [EC: 1.8.98.5]

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit A (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1 or 1.8.98.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ04 at UniProt or InterPro

Protein Sequence (654 amino acids)

>MMP_RS04295 CoB--CoM heterodisulfide reductase iron-sulfur subunit A family protein (Methanococcus maripaludis S2)
MEEPKIGVYVCHCGVNIGGVVDCENVARTAEGLENVVIARDYKYMCADPGQELIKKDIKE
LGLNRVIVAACSPRLHEPTFRRCVEEAGLNPFLFEFANIREHCSWVHMKEKEKATEKAND
LVRMAVAKARQLEPLDYLNVPVTKRAMVIGAGVAGIQAALDLGDAGYETIVVEKTPSVGG
RMAQLDKVFPTNDCSICILAPKMVDVAKHPNIKLYSYSEVKDVKGYIGNFKVKIEKKPRY
LSEEKCTGCGSCEEVCPISVPNEFDMGIGLRKAIYKPFPQAVPAKYTIDKESCIDCGLCA
KVCGPQAIDYGQKPEIIEAEVGTIISAIGYDPYDPTEKEEYGYGKIPNVITSMELERMIN
ASGPTMGKVIRPSDGQKPKRIAFIQCVGSRDAKIGKKYCSNVCCMYAMKNSQLIKEKAPE
TDIDIYYMDIRAFGKGYEEFYERSSKQYGIKFIRGRPAQVLDNPDGDNPIIRSEDTLLGE
IFENEYDLVVLSVGMVPTSTADEVQKLLGVSRSADRFFMEAHPKLKPVDTATDGIYLAGA
CQGPKDIPSSVAQGSAAASRAAIPLAKGEVQVEPIVVTIDENVCGACGICVQQCPYGAPR
FVEKDGKVVAEVLSALCKGCGTCAAGCPSGALEQSHFKTSQIYGQIEGAFKDSY