Protein Info for MMP_RS04255 in Methanococcus maripaludis S2

Annotation: coenzyme F420 hydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR03289: coenzyme F420 hydrogenase, subunit beta" amino acids 4 to 277 (274 residues), 456.2 bits, see alignment E=1.5e-141 PF04422: FrhB_FdhB_N" amino acids 11 to 86 (76 residues), 86.2 bits, see alignment E=1.4e-28 PF04432: FrhB_FdhB_C" amino acids 95 to 247 (153 residues), 186.5 bits, see alignment E=2.8e-59

Best Hits

Swiss-Prot: 85% identical to FRHB_METVO: Coenzyme F420 hydrogenase subunit beta (frhB) from Methanococcus voltae

KEGG orthology group: K00441, coenzyme F420 hydrogenase beta subunit [EC: 1.12.98.1] (inferred from 100% identity to mmp:MMP0817)

MetaCyc: 54% identical to factor F420-reducing hydrogenase beta subunit (Methanosarcina barkeri)
Coenzyme F420 hydrogenase. [EC: 1.12.98.1]

Predicted SEED Role

"Coenzyme F420 hydrogenase beta subunit (FrcB) (EC 1.12.98.1)" in subsystem Coenzyme F420 hydrogenase (EC 1.12.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.98.1

Use Curated BLAST to search for 1.12.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ12 at UniProt or InterPro

Protein Sequence (282 amino acids)

>MMP_RS04255 coenzyme F420 hydrogenase subunit beta (Methanococcus maripaludis S2)
MDPFGTYKTAISARATDKAILKKSQDGGIISASYIYGLENGLLDGVIVANTEDGFKAAPK
IATTPEEVLSAAGTKYTVSPNVSVLKDAVREYALEKVGIVGTPCQVRAIRKLMKYPMGFR
HTDSKIALVMGIFCMENFPYEGMKAIVEQYAGIRMNDVLKTDIGKGKFWVYSKSGDVKAV
PLKDTHMYEQKSCHVCMDYTAELADISTGSVGSPDGWSTIFVRTAKGEEYLNKMVEAGAL
ETKPIDDVKPGLDLVQKLALQKKEKNDKEIAHRKEIGLPVPY