Protein Info for MMP_RS04220 in Methanococcus maripaludis S2

Annotation: queuosine precursor transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 32 to 32 (1 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 12 to 200 (189 residues), 169.1 bits, see alignment E=5.5e-54 PF02592: Vut_1" amino acids 37 to 195 (159 residues), 185.9 bits, see alignment E=3.1e-59

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 100% identity to mmp:MMP0810)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ19 at UniProt or InterPro

Protein Sequence (202 amino acids)

>MMP_RS04220 queuosine precursor transporter (Methanococcus maripaludis S2)
LDKSKKLEILKALFYTCMILANVIAVKIGSFWGYVMTVGILTYPITYLMTDIISECWSKE
EARNTVIFGFVLSVISVIVTQSAVLVPNAPFYDGSAFEAVFNFVPRVVLASLMAYFVSQN
IDVSLFHKIRSYTGKKHLWIRNNISTMVSQLFDSFLFISIAFYGILPIDAIITMIGVQYG
FKFIIAIMDTPFIYLGRHWIEK