Protein Info for MMP_RS04150 in Methanococcus maripaludis S2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 340 (317 residues), 123.5 bits, see alignment E=5e-40

Best Hits

Swiss-Prot: 41% identical to NEPI_SALG2: Purine ribonucleoside efflux pump NepI (nepI) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K03445, MFS transporter, DHA1 family, purine ribonucleoside efflux pump (inferred from 100% identity to mmp:MMP0796)

Predicted SEED Role

"Arabinose efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ33 at UniProt or InterPro

Protein Sequence (404 amino acids)

>MMP_RS04150 MFS transporter (Methanococcus maripaludis S2)
MEENTTNQIINDNKSAWGAIWAMSLCAMVLVASEFMPVSLLTPIATDLQITEGTAGQSIS
ISGVFALITSLFLTQIIGNKDRRHVLLFFTALTGISGVLVAFAPDSTMLMIGRALLGMCI
GGFWSMSAATVMRIVSASSVPKALAILNGGTALSTTVAAPMGSFLGGIIGWRGAFFMIVP
LAFIAFIWQYKSIPKLPKENSNEQKEKFGSVFGLLKNWKVALGMISVMLFFMGQSALFTY
LRPFLEMVTKVNVETLSLVLLSMGIFGLIGTFIIEIMLKKRLYSLIIIIPFLMAITAVLM
LSFGTSLAAVFVLISIWGFLATSAPVAWWTWLSRILPTRAEAGGGLMVAIIQLAITLGAA
FGGVFFDTAGYQSTFMFSALILGIATIMACITGFHVYRINKNKN